missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NAP1L1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94307-0.02ml
This item is not returnable.
View return policy
Description
NAP1L1 Polyclonal antibody specifically detects NAP1L1 in Human, Mouse samples. It is validated for Western Blot
Specifications
| NAP1L1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| hNRP, HSP22-like protein interacting protein, MGC23410, MGC8688, NAP1, NAP-1 related protein, NAP1LFLJ16112, NRPNAP-1-related protein, nucleosome assembly protein 1-like 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NAP1L1 (P55209). FFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ | |
| 0.02 mL | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 4673 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction