missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAP1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35089-100ul
This item is not returnable.
View return policy
Description
RAP1A Polyclonal antibody specifically detects RAP1A in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| RAP1A | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:100 | |
| C21KG, G-22K, GTP-binding protein smg p21A, KREV-1, KREV1Ras-related protein Krev-1, RAP1, RAP1A, member of RAS oncogene family, ras-related protein Rap-1A, RAS-related protein RAP1A, SMGP21 | |
| A synthetic peptide corresponding to a sequence within amino acids 39-138 of human RAP1A (NP_002875.1).,, Sequence:, SYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQW | |
| 100 μL | |
| Cell Cycle and Replication, Endosome Markers | |
| 5906 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction