missing translation for 'onlineSavingsMsg'
Learn More

Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18653252 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18653252 0.02 mL 0.02mL
18649051 0.1 mL 0.01mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18653252 Supplier Novus Biologicals Supplier No. NBP2939680.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Muscarinic Acetylcholine Receptor M1/CHRM1 Polyclonal antibody specifically detects Muscarinic Acetylcholine Receptor M1/CHRM1 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Muscarinic Acetylcholine Receptor M1/CHRM1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias cholinergic receptor, muscarinic 1, HM1, M1, M1R, MGC30125, muscarinic acetylcholine receptor M1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-460 of human Muscarinic Acetylcholine Receptor M1/CHRM1 (NP_000729.2). WELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 1128
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.