missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Musashi-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-57163-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Musashi-1 Polyclonal specifically detects Musashi-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spécification
| Musashi-1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| Musashi (Drosophila) homolog 1, musashi homolog 1 (Drosophila), Musashi-1, RNA-binding protein Musashi homolog 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MSI1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA | |
| 25 μL | |
| Cancer, Cellular Markers, Neurodegeneration, Neuronal Cell Markers, Neuronal Stem Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells | |
| 4440 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu