missing translation for 'onlineSavingsMsg'
Learn More
Learn More
mu Crystallin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 572.00€
Specifications
| Antigen | mu Crystallin |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|
18279793
|
Novus Biologicals
NBP2-55172 |
100 μL |
572.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18617197
|
Novus Biologicals
NBP2-55172-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
mu Crystallin Polyclonal specifically detects mu Crystallin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifica
| mu Crystallin | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1428 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| crystallin, mu, DFNA40NADP-regulated thyroid-hormone binding protein, mu-crystallin homolog, NADP-regulated thyroid-hormone-binding protein, THBP | |
| CRYM | |
| IgG | |
| Affinity Purified |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto