missing translation for 'onlineSavingsMsg'
Learn More
Learn More
mtTFA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56077
This item is not returnable.
View return policy
Description
mtTFA Polyclonal specifically detects mtTFA in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| mtTFA | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| mitochondrial transcription factor A, MtTF1, mtTFA, TCF-6, TCF6L1, TCF6L2Mitochondrial transcription factor 1, TCF6TCF6L3, Transcription factor 6, Transcription factor 6-like 2, Transcription factor 6-like 2 (mitochondrial transcription factor), transcription factor A, mitochondrial | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TFAM | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAE | |
| 100 μL | |
| Cell Cycle and Replication, Transcription Factors and Regulators | |
| 7019 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction