missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16187981

MTAP, Mouse anti-Human, Clone: 2G4, Abnova™

Product Code. 16187981 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
16187981 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16187981 Supplier Novus Biologicals Supplier No. H00004507M01
 Restricted Item
Estimated Shipment: 01-10-2026
Add to basket
Add to basket
This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS

Specifications

Antigen MTAP
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2G4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene methylthioadenosine phosphorylase
Gene Accession No. BC018625
Gene Alias MSAP/c86fus
Gene Symbols MTAP
Host Species Mouse
Immunogen MTAP (AAH18625, 1 a.a. ∼ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4507
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less

Safety and Handling

compliance-icons
Product Identifier
  • MTAP monoclonal antibody (M01), clone 2G4
 Signal Word
  • Warning
 Hazard Category
  • Acute toxicity Category 4
  • Serious eye damage/eye irritation Category 2
  • Skin corrosion/irritation Category 2
 Hazard Statement
  • H302-Harmful if swallowed.
  • H315-Causes skin irritation.
  • H319-Causes serious eye irritation.
 Precautionary Statement
  • P102-Keep out of reach of children.
  • P103-Read label before use.
  • P233-Keep container tightly closed.
  • P264-Wash thoroughly after handling.
  • P270-Do not eat, drink or smoke when using this product.
  • P280-Wear protective gloves/protective clothing/eye protection/face protection.
  • P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
  • P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
  • P404-Store in a closed container.
  • P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
 Supplemental information
  • MIXTURE LIST-Contain: sodium phosphate dibasic, potassium phosphate monobasic
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.