missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MSP/MST1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 540.75€
Specifications
| Antigen | MSP/MST1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18447931
|
Novus Biologicals
NBP1-85330-25ul |
25 μL |
292.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18219856
|
Novus Biologicals
NBP1-85330 |
0.1 mL |
 572.00€ 540.75€ / 0.10mL Save 31.25€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
MSP/MST1 Polyclonal specifically detects MSP/MST1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifica
| MSP/MST1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| D3F15S2, EC 3.4.21, hepatocyte growth factor-like protein homolog, HGFLhepatocyte growth factor-like protein, macrophage stimulating 1 (hepatocyte growth factor-like), Macrophage stimulatory protein, Macrophage-stimulating protein, MSPDNF15S2, NF15S2 | |
| MST1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4485 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto