missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MSP/MST1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 540.75€
Specifications
| Antigen | MSP/MST1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18447931
|
Novus Biologicals
NBP1-85330-25ul |
25 μL |
292.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18219856
|
Novus Biologicals
NBP1-85330 |
0.1 mL |
572.00€ 540.75€ / 0.10mL Save 31.25€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MSP/MST1 Polyclonal specifically detects MSP/MST1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MSP/MST1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| D3F15S2, EC 3.4.21, hepatocyte growth factor-like protein homolog, HGFLhepatocyte growth factor-like protein, macrophage stimulating 1 (hepatocyte growth factor-like), Macrophage stimulatory protein, Macrophage-stimulating protein, MSPDNF15S2, NF15S2 | |
| MST1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4485 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title