missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18367499

MRPS28 Antibody, Novus Biologicals™

Product Code. 18367499 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18367499 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18367499 Supplier Novus Biologicals Supplier No. H00028957B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

MRPS28 Polyclonal antibody specifically detects MRPS28 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MRPS28
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_054737.1
Gene Alias 28S ribosomal protein S35, mitochondrial, FLJ22853, mitochondrial 28S ribosomal protein S35, mitochondrial ribosomal protein S28, MRP-S2828S ribosomal protein S28, mitochondrial, MRP-S35, MRPS35HSPC007, S28mt, S35mt
Host Species Mouse
Immunogen MRPS28 (NP_054737.1, 1 a.a. - 187 a.a.) full-length human protein. MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 28957
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.