missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRPL43 Antibody - Azide and BSA Free, Novus Biologicals™

MRPL43 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18693121 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18693121 0.02 mL 0.02mL
18695790 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18693121 Supplier Novus Biologicals Supplier No. NBP2935270.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MRPL43 Polyclonal antibody specifically detects MRPL43 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen MRPL43
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias 39S ribosomal protein L43, mitochondrial, bMRP36a, L43mt, MGC17989, MGC48892, Mitochondrial ribosomal protein bMRP36a, mitochondrial ribosomal protein L43, MRP-L43
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-155 of human MRPL43 (NP_789762.1). LNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQ
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Endocrinology
Primary or Secondary Primary
Gene ID (Entrez) 84545
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.