missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL34 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93040-0.02ml
This item is not returnable.
View return policy
Description
MRPL34 Polyclonal antibody specifically detects MRPL34 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| MRPL34 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| L34mtMGC24974, MGC2633, mitochondrial ribosomal protein L34, MRP-L34,39S ribosomal protein L34, mitochondrial | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 16-92 of human MRPL34 (NP_076426.1). AALLGGRWLQPRAWLGFPDAWGLPTPQQARGKARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH | |
| 0.02 mL | |
| Stem Cell Markers | |
| 64981 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction