missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL18 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94040-0.02ml
This item is not returnable.
View return policy
Description
MRPL18 Polyclonal antibody specifically detects MRPL18 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| MRPL18 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| HSPC071,39S ribosomal protein L18, mitochondrial, L18mt, mitochondrial ribosomal protein L18, MRP-L18 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human MRPL18 (NP_054880.2). MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA | |
| 0.02 mL | |
| Endocrinology | |
| 29074 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur