missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL18 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94040-0.02ml
This item is not returnable.
View return policy
Description
MRPL18 Polyclonal antibody specifically detects MRPL18 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| MRPL18 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| HSPC071,39S ribosomal protein L18, mitochondrial, L18mt, mitochondrial ribosomal protein L18, MRP-L18 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human MRPL18 (NP_054880.2). MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA | |
| 0.02 mL | |
| Endocrinology | |
| 29074 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction