missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MRPL13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | MRPL13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MRPL13 Polyclonal specifically detects MRPL13 in Human samples. It is validated for Western Blot.Specifications
| MRPL13 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| 39S ribosomal protein L13, mitochondrial, L13, L13A, L13mtRPML13, mitochondrial ribosomal protein L13, MRP-L13, RPL13 | |
| MRPL13 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BYD1 | |
| 28998 | |
| Synthetic peptides corresponding to MRPL13(mitochondrial ribosomal protein L13) The peptide sequence was selected from the middle region of MRPL13. Peptide sequence AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title