missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
MPZL1 Polyclonal antibody specifically detects MPZL1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | MPZL1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | FLJ21047, immunoglobulin family transmembrane protein, MPZL1b, myelin protein zero-like 1, myelin protein zero-like protein 1, protein zero related, Protein zero-related, PZR1b, PZRb, PZRPZRa |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 195-269 of human MPZL1 (NP_003944.1). NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?