missing translation for 'onlineSavingsMsg'
Learn More

MPZL1 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18691441 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18691441 0.02 mL 0.02mL
18613541 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18691441 Supplier Novus Biologicals Supplier No. NBP2938450.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

MPZL1 Polyclonal antibody specifically detects MPZL1 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MPZL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias FLJ21047, immunoglobulin family transmembrane protein, MPZL1b, myelin protein zero-like 1, myelin protein zero-like protein 1, protein zero related, Protein zero-related, PZR1b, PZRb, PZRPZRa
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 195-269 of human MPZL1 (NP_003944.1). NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9019
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.