missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MPPED2 (Human) Recombinant Protein

Human MPPED2 full-length ORF ( AAH31582, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000744-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16162451

  • 359.00€ / 10µg

Estimated Shipment: 22-08-2022
to see stock.
Add to basket

Description

Description

  • Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Specifications

Specifications

AAH31582
metallophosphoesterase domain containing 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MPPED2
GST
744
Wheat germ expression system
10 μg
239FB, C11orf8, D11S302E, FAM1B, Hs.46638, dJ1024C24.1, dJ873F21.1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers