missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOV10L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | MOV10L1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MOV10L1 Polyclonal specifically detects MOV10L1 in Human samples. It is validated for Western Blot.Specifications
| MOV10L1 | |
| Polyclonal | |
| Rabbit | |
| Q9BXT6 | |
| 54456 | |
| Synthetic peptides corresponding to MOV10L1(Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse)) The peptide sequence was selected from the N terminal of MOV10L1. Peptide sequence LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DJ402G11.8, DKFZp434B0717, EC 3.6.1, EC 3.6.4.13, FLJ33421, Moloney leukemia virus 10-like protein 1, Mov10 (mouse)-like 1, Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse), Mov10-like 1, MOV10-like protein 1, putative helicase Mov10l1 | |
| MOV10L1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title