missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Mouse Egf (P01132, 977 a.a. - 1029 a.a.) Partial Recombinant Protein

Product Code. 16222110
Change view
Click to view available options
Quantity:
500 μg
Unit Size:
500µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16222110 500 μg 500µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16222110 Supplier Abnova™ Supplier No. P4351.500ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Used for Func, SDS-PAGE

Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Specifications

Accession Number P01132
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 13645
Molecular Weight (g/mol) 6.2kDa
Name Egf (Mouse) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 500 μg
Immunogen NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1EU/μg) (determined by LAL gel clot method)
Gene Alias AI790464
Common Name Egf
Gene Symbol Egf
Biological Activity The ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 0.1ng/mL, corresponding to a specific activity of ≥ 1 x 107 units/mg.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.