missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MNAB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Specifications
| Antigen | MNAB |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18698878
|
Novus Biologicals
NBP2-68785-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631648
|
Novus Biologicals
NBP2-68785 |
100 μg |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MNAB Polyclonal antibody specifically detects MNAB in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| MNAB | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol | |
| 54542 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title