missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MIS12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | MIS12 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18465851
|
Novus Biologicals
NBP1-92118-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18490412
|
Novus Biologicals
NBP1-92118 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MIS12 Polyclonal antibody specifically detects MIS12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| MIS12 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, DNA Repair | |
| PBS (pH 7.2) and 40% Glycerol | |
| 79003 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 2510025F08Rik, hMis12, homolog of yeast Mis12, KNTC2AP, MGC2488, MIS12 homolog, MIS12, MIND kinetochore complex component, homolog (S. pombe), MIS12, MIND kinetochore complex component, homolog (yeast), MTW1, protein MIS12 homolog | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KEIEQLQEKYKTELCTKQALLAELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKI | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title