missing translation for 'onlineSavingsMsg'
Learn More
Learn More
METTL2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | METTL2B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
METTL2B Polyclonal specifically detects METTL2B in Human samples. It is validated for Western Blot.Specifications
| METTL2B | |
| Polyclonal | |
| Rabbit | |
| Q6P1Q9 | |
| 55798 | |
| Synthetic peptides corresponding to METTL2B(methyltransferase like 2B) The peptide sequence was selected from the N terminal of METTL2B. Peptide sequence INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.1.1, EC 2.1.1.-, FLJ11350, FLJ12760, methyltransferase like 2, methyltransferase like 2B, methyltransferase-like protein 2B, METL, METTL2, METTL2A, PSENIP1 | |
| METTL2B | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title