missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Matrin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38211-20ul
This item is not returnable.
View return policy
Description
Matrin 3 Polyclonal antibody specifically detects Matrin 3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| Matrin 3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:100 - 1:200 | |
| distal 2, DKFZp686K0542, DKFZp686K23100, matrin 3, matrin-3, vocal cord and pharyngeal weakness with distal myopathy | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 747-847 of human Matrin 3 (NP_001181884.1).,, Sequence:, SSENADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEERRQKKET | |
| 20 μL | |
| Cancer | |
| 9782 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction