missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MATH1 Antibody (2G8), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00000474-M07
This item is not returnable.
View return policy
Description
MATH1 Monoclonal antibody specifically detects MATH1 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
| MATH1 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| ATH1protein atonal homolog 1, atonal homolog 1 (Drosophila), BHLHA14, bHLHa14Math1, Class A basic helix-loop-helix protein 14, hATH1, Helix-loop-helix protein hATH-1, MATH-1 | |
| ATOH1 (NP_005163.1, 266 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS | |
| 0.1 mg | |
| Cancer | |
| 474 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Immunocytochemistry | |
| 2G8 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| NP_005163 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction