missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MARK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€
Specifications
| Antigen | MARK2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MARK2 Polyclonal specifically detects MARK2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| MARK2 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| EC 2.7.11, EC 2.7.11.1, ELKL motif kinase, ELKL motif kinase 1, EMK-1, EMK1PAR-1, MAP/microtubule affinity-regulating kinase 2MGC99619, PAR1 homolog, Par1b, Ser/Thr protein kinase PAR-1B, serine/threonine protein kinase EMK, serine/threonine-protein kinase MARK2 | |
| MARK2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 2011 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title