missing translation for 'onlineSavingsMsg'
Learn More

MARCO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

318.00€ - 571.00€

Specifications

Antigen	MARCO
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18659205 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-39004-25ul	25 μL	318.00€ 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18746823 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-39004	0.1 mL	571.00€ 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

MARCO Polyclonal specifically detects MARCO in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	MARCO
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q9UEW3
Gene ID (Entrez)	8685
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2
Gene Symbols	MARCO
Isotype	IgG
Purification Method	Affinity Purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

MARCO Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents