missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MAL Recombinant Protein

Name: Abnova&trade; MAL Recombinant Protein
Brand: Abnova&trade;
SKU: 16107601
Price: 528.00 EUR

Brand: Abnova™ H00004118-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16107601

Quantity
Estimated Shipment: 17-07-2023
to see stock.

Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH00458
Format	Solution
Gene ID (Entrez)	4118
Name	MAL (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	MAL
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	42.57
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS
Common Name	MAL
Cross Reactivity	Human
Recombinant	Yes

Description