missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MAL Recombinant Protein

335.00€ - 508.00€

Accession Number	AAH00458
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	4118
Molecular Weight (g/mol)	42.57

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16197591 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00004118-P01.10UG	10 ug	335.00€ 10µg View alternative products Save Up to »	Estimated Shipment: 07-06-2024 Log in to see stock.	Add to basket

16107601 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00004118-P01.25UG	25 ug	508.00€ 25µg View alternative products Save Up to »	Estimated Shipment: 07-06-2024 Log in to see stock.	Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH00458
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	42.57
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	MAL
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	4118
Name	MAL (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS
Common Name	MAL
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Description