missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ MAGEA11 (Human) Recombinant Protein

Human MAGEA11 full-length ORF ( AAH04479.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00004110-P01.10ug

Product Code. 16107581

Quantity

Estimated Shipment: 21-10-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

Sequence: MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV

Specifications

Accession Number	AAH04479.1
Name	melanoma antigen family A, 11
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	MAGEA11
Protein Tag	GST

Gene ID (Entrez)	4110
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	MAGE-11, MAGE11, MAGEA-11, MGC10511
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description