missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MAD2L1-binding protein Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00€ - 507.00€
Specifications
| Antigen | MAD2L1-binding protein |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230227
|
Novus Biologicals
NBP3-33204-100ul |
100 μL |
507.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228042
|
Novus Biologicals
NBP3-33204-20ul |
20 μL |
213.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MAD2L1-binding protein Monoclonal antibody specifically detects MAD2L1-binding protein in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Specifications
| MAD2L1-binding protein | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 9587 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Caught by MAD2 protein, CMT2MGC11282, dJ261G23.1, KIAA0110RP1-261G23.6, MAD2L1 binding protein, MAD2L1-binding protein | |
| A synthetic peptide corresponding to a sequence within amino acids 175-274 of human MAD2L1-binding protein (Q15013).,, Sequence:, YSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title