missing translation for 'onlineSavingsMsg'
Learn More
Learn More
M-Ras/R-Ras3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00€ - 507.00€
Specifications
| Antigen | M-Ras/R-Ras3 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226520
|
Novus Biologicals
NBP3-33251-20ul |
20 μL |
213.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231583
|
Novus Biologicals
NBP3-33251-100ul |
100 μL |
507.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
M-Ras/R-Ras3 Monoclonal antibody specifically detects M-Ras/R-Ras3 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| M-Ras/R-Ras3 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 22808 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FLJ42964, muscle and microspikes RAS, muscle RAS oncogene homolog, ras-related protein M-Ras, Ras-related protein R-Ras3, R-RAS3, RRAS3M-RAs | |
| A synthetic peptide corresponding to a sequence within amino acids 109-208 of human M-Ras/R-Ras3 (O14807).,, Sequence:, LILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title