missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LZTFL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | LZTFL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
LZTFL1 Polyclonal specifically detects LZTFL1 in Human samples. It is validated for Western Blot.Specifications
| LZTFL1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ36386, leucine zipper transcription factor-like 1, leucine zipper transcription factor-like protein 1 | |
| LZTFL1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q9NQ48 | |
| 54585 | |
| Synthetic peptides corresponding to LZTFL1(leucine zipper transcription factor-like 1) The peptide sequence was selected from the C terminal of LZTFL1. Peptide sequence VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED. | |
| Primary | |
| 34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title