missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free, Novus Biologicals™

Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

231.00€ - 468.00€

Specifications

Antigen Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3
Dilution Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
18613471
View Documents
missing translation for 'viewProductCertificates'
Novus Biologicals
NBP2-92981-0.02ml 		0.02 mL This item has been discontinued and is no longer available. View the product for possible alternatives or contact our Technical Support team on +351 21 425 33 50 for assistance
 		N/A View alternative products
Save Up to  »
18638110
View Documents
missing translation for 'viewProductCertificates'
Novus Biologicals
NBP2-92981-0.1ml 		0.1 mL This item has been discontinued and is no longer available. View the product for possible alternatives or contact our Technical Support team on +351 21 425 33 50 for assistance
 		N/A View alternative products
Save Up to  »
Description

Description

Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Polyclonal antibody specifically detects Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications

Specifications

Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
Cancer, Chromatin Research, Transcription Factors and Regulators
PBS with 50% glycerol, pH7.3.
23135
IgG
Affinity purified
Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin
Polyclonal
Purified
RUO
Human, Mouse, Rat
EC 1.14.11, EC 1.14.11.-, JmjC domain-containing protein 3, JMJD3lysine-specific demethylase 6B, jumonji domain containing 3, histone lysine demethylase, Jumonji domain-containing protein 3, KIAA0346jumonji domain containing 3, lysine (K)-specific demethylase 6B, Lysine demethylase 6B
Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA
Primary
Store at -20°C. Avoid freeze-thaw cycles.
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.