missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRRK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | LRRK1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231886
|
Novus Biologicals
NBP3-35786-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231221
|
Novus Biologicals
NBP3-35786-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LRRK1 Polyclonal antibody specifically detects LRRK1 in Human samples. It is validated for ELISA,Western BlotSpecifications
| LRRK1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.3), 50% glycerol | |
| 79705 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.7.11.1, FLJ23119, KIAA1790FLJ27465, leucine-rich repeat kinase 1, leucine-rich repeat serine/threonine-protein kinase 1, RIPK6, Roco1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human LRRK1 (NP_078928.3).,, Sequence:, SMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRAAYRRGDRGGARDLLEEACDQCASQLEKGQL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title