missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LRAT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | LRAT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LRAT Polyclonal specifically detects LRAT in Human samples. It is validated for Western Blot.Specifications
| LRAT | |
| Polyclonal | |
| Rabbit | |
| NP_004735 | |
| 9227 | |
| The immunogen for this antibody is LRAT. Peptide sequence LEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.3.1.135, LCA14, lecithin retinol acyltransferase, lecithin retinol acyltransferase (phosphatidylcholine--retinolO-acyltransferase), MGC33103, Phosphatidylcholine--retinol O-acyltransferase | |
| LRAT | |
| IgG | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title