missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LONRF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Specifications
| Antigen | LONRF3 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18119137
|
Novus Biologicals
NBP2-47391 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18674326
|
Novus Biologicals
NBP2-47391-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
LONRF3 Polyclonal specifically detects LONRF3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| LONRF3 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 79836 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LMDPAKVKGDGQQHHMKDQEEEEEKWDATSPKAASSKTGKCQEKKRKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127 | |
| LONRF3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title