missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LMO4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€
Specifications
| Antigen | LMO4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LMO4 Polyclonal specifically detects LMO4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| LMO4 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Tumor Suppressors | |
| Breast tumor autoantigen, LIM domain only 4, LIM domain only protein 4, LIM domain transcription factor LMO4, LMO-4 | |
| LMO4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 8543 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title