missing translation for 'onlineSavingsMsg'
Learn More

LIR-8/CD85c/LILRB5 Antibody, Novus Biologicals™

Product Code. 18490681 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18490681 25 μL 25µL
18247946 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18490681 Supplier Novus Biologicals Supplier No. NBP18457525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

LIR-8/CD85c/LILRB5 Polyclonal specifically detects LIR-8/CD85c/LILRB5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LIR-8/CD85c/LILRB5
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:20-1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CD85 antigen-like family member C, CD85c, CD85c antigen, Leukocyte immunoglobulin-like receptor 8, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LIR8CD85C, LIR-8leukocyte immunoglobulin-like receptor subfamily B member 5, member 5
Gene Symbols LILRB5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10990
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.