missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
LIR-8/CD85c/LILRB5 Polyclonal specifically detects LIR-8/CD85c/LILRB5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | LIR-8/CD85c/LILRB5 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:20-1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | CD85 antigen-like family member C, CD85c, CD85c antigen, Leukocyte immunoglobulin-like receptor 8, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LIR8CD85C, LIR-8leukocyte immunoglobulin-like receptor subfamily B member 5, member 5 |
| Gene Symbols | LILRB5 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?