missing translation for 'onlineSavingsMsg'
Learn More
Learn More
LETM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56618
This item is not returnable.
View return policy
Description
LETM2 Polyclonal specifically detects LETM2 in Human samples. It is validated for Western Blot.
Specifications
| LETM2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ25409, LETM1 and EF-hand domain-containing protein 2, LETM1 domain-containing protein LETM2, mitochondrial, leucine zipper-EF-hand containing transmembrane protein 1-like protein, leucine zipper-EF-hand containing transmembrane protein 2, Leucine zipper-EF-hand-containing transmembrane protein 1-like | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 137994 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q2VYF4-3 | |
| LETM2 | |
| Synthetic peptides corresponding to LETM2(leucine zipper-EF-hand containing transmembrane protein 2) The peptide sequence was selected from the N terminal of LETM2. Peptide sequence KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%. | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction