missing translation for 'onlineSavingsMsg'
Learn More
Learn More
L3MBTL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Specifications
| Antigen | L3MBTL3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18264123
|
Novus Biologicals
NBP2-58442 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18644639
|
Novus Biologicals
NBP2-58442-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
L3MBTL3 Polyclonal specifically detects L3MBTL3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spécification
| L3MBTL3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 84456 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSLKADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEEEKAVAVPAKLFKEH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| H-l(3)mbt-like protein 3, KIAA1798, l(3)mbt-like 3 (Drosophila), L(3)mbt-like protein 3, lethal(3)malignant brain tumor-like protein 3, MBT1, MBT-1, RP11-73O6.1 | |
| L3MBTL3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit