missing translation for 'onlineSavingsMsg'
Learn More
Learn More
L-Selectin/CD62L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-76545
This item is not returnable.
View return policy
Description
L-Selectin/CD62L Polyclonal specifically detects L-Selectin/CD62L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| L-Selectin/CD62L | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
| CD62L, CD62L antigen, gp90-MEL, hLHRc, LAM-1, LAM1LECAM1, Leu-8, LEU8, Leukocyte adhesion molecule 1, Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1, LNHRTQ1, LSEL, L-selectin, Lyam-1, LYAM1CD62 antigen-like family member L, Lymph node homing receptor, lymphocyte adhesion molecule 1, pln homing receptor, PLNHR, selectin L | |
| Rabbit | |
| Affinity Purified | |
| Adaptive Immunity, B Cell Development and Differentiation Markers, Cardiovascular Biology, Glycobiology, Immunology, Lipid and Metabolism, Myeloid derived Suppressor Cell, Signal Transduction, Stem Cells | |
| 6402.0 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| SELL | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction