missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ KLRB1 (Human) Recombinant Protein
Human KLRB1 partial ORF ( NP_002249, 126 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00003820-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
Specifications
| NP_002249 | |
| killer cell lectin-like receptor subfamily B, member 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| KLRB1 | |
| GST |
| 3820 | |
| Wheat germ expression system | |
| 10 μg | |
| CD161, CLEC5B, MGC138614, NKR, NKR-P1, NKR-P1A, NKRP1A, hNKR-P1A | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |