missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ KLF6 (Human) Recombinant Protein

Human KLF6 full-length ORF ( AAH04301.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001316-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193401

  • 335.00€ / 10µg
Estimated Shipment: 28-08-2024
to see stock.
Add to basket

Description

Description

  • Sequence: MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPF
Specifications

Specifications

AAH04301.1
Kruppel-like factor 6
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KLF6
GST
1316
Wheat germ expression system
10 μg
BCD1, COPEB, CPBP, DKFZp686N0199, GBF, PAC1, ST12, ZF9
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers