missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kif4A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€
Specifications
| Antigen | Kif4A |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Kif4A Polyclonal specifically detects Kif4A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Kif4A | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Lipid and Metabolism, Mitotic Regulators, Neuroscience, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 24137 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SITVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| chromokinesin-A, chromosome-associated kinesin KIF4A, FLJ12530, FLJ12655, FLJ14204, FLJ20631, HSA271784, KIF4G1, KIF4KIF4-G1, kinesin family member 4A | |
| KIF4A | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title