missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KIF19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | KIF19 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KIF19 Polyclonal specifically detects KIF19 in Human samples. It is validated for Western Blot.Specifications
| KIF19 | |
| Polyclonal | |
| Rabbit | |
| Q8N1X8 | |
| 124602 | |
| Synthetic peptides corresponding to FLJ37300 The peptide sequence was selected from the N terminal of FLJ37300. Peptide sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ37300, KIF19A, kinesin family member 19, kinesin-like protein KIF19 | |
| KIF19 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title