missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KDM2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35627-100ul
This item is not returnable.
View return policy
Description
KDM2B Polyclonal antibody specifically detects KDM2B in Human samples. It is validated for ELISA,Western Blot
Specifications
| KDM2B | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| [Histone-H3]-lysine-36 demethylase 1B, CXXC2F-box protein FBL10, CXXC-type zinc finger protein 2, Fbl10, F-box and leucine-rich repeat protein 10JEMMA (Jumonji domain, EMSY-interactor, methyltransferase motif) protein, FBXL10, JHDM1BF-box/LRR-repeat protein 10, JmjC domain-containing histone demethylation protein 1B, jumonji C domain-containing histone demethylase 1B, Jumonji domain-containing EMSY-interactor methyltransferase motif protein, lysine (K)-specific demethylase 2B, lysine-specific demethylase 2B, PCCX2EC 1.14.11.27, protein containing CXXC domain 2, Protein JEMMA, Protein-containing CXXC domain 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1).,, Sequence:, SGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSIN | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 84678 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction