missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KALRN Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
461.00€
Specifications
| Antigen | KALRN |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
KALRN Polyclonal specifically detects KALRN in Human samples. It is validated for Western Blot.Specifications
| KALRN | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS buffer, 2% sucrose | |
| 8997 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ARHGEF24, DUETFLJ16443, DUO, EC 2.7.11.1, FLJ12332, FLJ18623, HAPIP, huntingtin-associated protein interacting protein (duo), Huntingtin-associated protein-interacting protein, Kalirin, kalirin, RhoGEF kinase, Protein Duo, serine/threonine kinase with Dbl- and pleckstrin homology domains, Serine/threonine-protein kinase with Dbl- and pleckstrin homology domain, TRADFLJ18196 | |
| The immunogen is a synthetic peptide directed towards the middle region of human KALRN (NP_001019831.2). Peptide sequence QGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLAARQ | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title