missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ JTB Recombinant Protein

Name: Abnova&trade; JTB Recombinant Protein
Brand: Abnova&trade;
SKU: 16105822
Price: 349.00 EUR

Brand: Abnova™ H00010899-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16105822

Quantity
Estimated Shipment: 07-07-2023
to see stock.

Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH00996.1
Format	Solution
Gene ID (Entrez)	10899
Name	JTB (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	JTB
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	41.8
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
Gene Alias	HJTB/HSPC222/PAR/hJT
Gene Symbol	JTB
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description