missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ISX Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79216-100UL
This item is not returnable.
View return policy
Description
ISX Polyclonal specifically detects ISX in Human samples. It is validated for Western Blot.
Specifications
| ISX | |
| Polyclonal | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| intestine-specific homeobox, RAXLX | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 91464 | |
| Human | |
| IgG |
| Western Blot | |
| LYOPH | |
| Western Blot 1:1000 | |
| NP_001008494 | |
| ISX | |
| Synthetic peptide directed towards the N terminal of human ISXThe immunogen for this antibody is ISX. Peptide sequence ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV. | |
| 100 μL | |
| Primary | |
| Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
RUO
Spot an opportunity for improvement?Share a Content Correction