missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IRF7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35066-20ul
This item is not returnable.
View return policy
Description
IRF7 Polyclonal antibody specifically detects IRF7 in Mouse samples. It is validated for ELISA,Western Blot
Specifications
| IRF7 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| interferon regulatory factor 7, interferon regulatory factor-7H, IRF-7, IRF7A, IRF-7H | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2).,, Sequence:, KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP | |
| 20 μL | |
| Transcription Factors and Regulators | |
| 3665 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction